lever.co

🖥 Status: up
🕒 Response Time: 0.317 sec
⬅️ Response Code: 200
lever.co

36 availability checks of lever.co had over the 1 996 day period starting from February 24, 2021. Lever.co was available 36 times from the aggregate checks conducted, with the latest recorded uptime on July 7, 2026, returning a code 200. No downtime occurrences were observed for lever.co during inspections conducted as of August 14, 2026. No response had an error status, according to the replies that were received as of August 14, 2026. Lever.co showed a response time of 0.317 seconds on July 7, 2026, contrasting the average of 1.023 seconds.

3.0
36
Last Updated: July 7, 2026

Lever overview

Domain
lever.co
Title
Lever | Flexible Recruiting Software for Today's Hiring Teams
Description
Find, nurture, and hire the best talent easily and efficiently with Lever’s powerful recruiting software. Elevate your hiring results and book a demo today.
Main Topic
Recruitment Software for Dynamic Hiring Teams
V Site Status Rank
2 393
Search Wikipedia
lever.co
Alternatives
alternatives to lever.co
Recently checked
watchmygirlfriend.tv

halfbakedharvest.com

Last Updated: April 11, 2026
Status: error
Response Time: 0.329 sec
Response Code: 403

votv.media

Last Updated: July 13, 2026
Status: down
Response Time: — sec
Response Code:

stv919.info

Last Updated: July 11, 2026
Status: down
Response Time: — sec
Response Code:

tauri-veins.tk

Last Updated: June 25, 2026
Status: down
Response Time: — sec
Response Code:

vevo.uz

Last Updated: July 4, 2026
Status: down
Response Time: — sec
Response Code:

na-ovoce.cz

Last Updated: August 14, 2026
Status: n/a
Response Time: 0 sec
Response Code: n/a

livecountdown.com

Last Updated: August 13, 2026
Status: up
Response Time: 1.579 sec
Response Code: 200

Lever.co
status check request map as of August 14, 2026

lever.co request, July 7, 2026

Country report for lever.co as of August 14, 2026

United States 100.00%
19:29
SiteTotal ChecksLast Modified
thumbtack.comthumbtack.com33January 28, 2021
watchmygirlfriend.tvwatchmygirlfriend.tv68November 19, 2020
lever.colever.co36February 24, 2021
game-game.com.uagame-game.com.ua59January 18, 2021
dstv.comdstv.com41January 28, 2021

Tauri-veins.tk

Lever.co

General SEO Report

Page TitlePage Title tips for lever.co: Using customer-focused language within a target keyword-embedded title to proactively solve a problem clearly stated can dramatically improve relevance metrics and engagement signals, a common SEO best practice that assumes character limitations, typically targeting 55-60 characters.
Lever | Flexible Recruiting Software for Today's Hiring Teams

Length: 66 characters
Meta DescriptionMeta Description tips for lever.co: Converting descriptive text into click-worthy copy requires balancing keyword density with readability; sacrificing clarity for keyword stuffing creates awkward, confusing text that frustrates users ultimately hindering results.
Find, nurture, and hire the best talent easily and efficiently with Lever’s powerful recruiting software. Elevate your hiring results and book a demo today.

Length: 162 characters
Meta KeywordsMeta Keywords tips for lever.co: Success in SEO today hinges on understanding search intent and delivering an exceptional user experience, factors completely independent of the meta keywords tag's outdated contribution to ranking signals.
no meta keywords data for lever.co
2026-08-14T09:17:06+00:00
Page ContentPage Content tips for lever.co: Create page content with a clear, persuasive introduction and a concise, compelling conclusion, framing the information for users and optimizing for completion, factors SEO increasingly considers.
Web Page Content Length: 94098 characters
H1 HeadingH1 Heading tips for lever.co: The H1 header provides a clear focal point for users, making the main content accessible at a glance; it functions effectively as the main page headline, improving both engagement and site usability.
Recruitment Software for Dynamic Hiring Teams

Count: 1 heading tag
H2 HeadingsH2 Headings tips for lever.co: Utilize descriptive text within H2 headers to target a wide range of related keyword phrases specific to user searches for the content or service being described, thereby improving overall keyword coverage.
Whatever Comes Next, Lever Moves With You
Why Lever?
Recognized by the Best in the Biz
Praised by the People Who Matter Most
Discover the Employ Advantage with Our AI Companions by Your Side
Real Options. Real Flexibility. For All the Ways You Hire.
Ready to Power Your Hiring Momentum?
Lever Talent Acquisition Software FAQs: Your Questions Answered
What is Lever and how does it support modern recruiting?
How does Lever’s applicant tracking system work?
Does Lever include AI Companion or recruitment automation tools or automation tools?
What integrations does Lever support?
How does Lever compare to other applicant tracking systems like Greenhouse, Workable, or Ashby?


Count: 13 heading tag
H3 HeadingsH3 Headings tips for lever.co: Imagine a technical specification page; the correct use of H3 headers allows you to clearly structure complex information so visitors can easily find and copy the desired specifications.
Tour Our Award-Winning Recruitment Software
See it in Action!
Integrated AI-Powered Interview Tool
Recruiting Realities: What’s Shaping TA Today
ROI That Shakes The Walls
The True AI Revolution in Talent Acquisition


Count: 6 heading tag
H4 HeadingsH4 Headings tips for lever.co: The proper implementation of H4 headers within a page structure contributes to faster page loading perceived speed by search engines, as organized markup simplifies content analysis and indexing complexity weighted against raw HTML file size.
no h4 headings data for lever.co
2026-08-14T09:17:06+00:00
H5-H6 HeadingsH5-H6 Headings tips for lever.co: Semantic accuracy and adherence to proper HTML standards in the hierarchy of H5 and H6 header tags significantly influence SEO performance, as recognized web crawlers from major search engines prioritize well-structured webpage layouts.
no h5-h6 headings data for lever.co
2026-08-14T09:17:06+00:00
Image ALT AttributesImage ALT Attributes tips for lever.co: Create custom alt text specifically tailored to each image to ensure that your content accurately matches the visible images present on your site, a practice that readily helps SEO through semantic relevance and user experience optimization, providing focus on core premise elements users desire.
https://www.lever.co/wp-content/uploads/2022/09/Lever_Employ_Logo_Horizontal_Turquoise_Black.png
https://www.lever.co/wp-content/uploads/2023/02/Interview.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Marketing.png
https://www.lever.co/wp-content/uploads/2023/02/High-Volume-Hiring.png
https://www.lever.co/wp-content/uploads/2023/02/Diversity-and-Inclusion.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Automation.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Analytics.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Communication.png
https://www.lever.co/wp-content/uploads/2023/02/Career-Site-Builder.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Add-Ons.png
and 16 more...


Count: 11 images with ALT attributes
Robots.txtRobots.txt tips for lever.co: By default all pages will be blocked if the entire domain servers a robots.txt file containing 'User-agent: *' 'Disallow: /' search engines must follow these direct instructions to crawl your site.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for lever.co: Properly formatted XML sitemaps are fundamental for informing search engines about every URL currently available on your site, regardless of its quality or importance, preventing the indexing of thin or low-value pages and directing resources towards optimizing the presentation and accessibility of your core content.
no xml sitemap data for lever.co
2026-08-14T09:17:06+00:00
Page SizePage Size tips for lever.co: Large page sizes can delay critical content rendering, negatively affecting user interaction; optimizing page size ensures users see important information quickly.
page size: 92 kb
Response TimeResponse Time tips for lever.co: Harness the power of instance autoscaling within your cloud platform architecture to dynamically shift compute resources based on response demands, ensuring optimal performance.
response time: 1.023 sec
Minify CSSMinify CSS tips for lever.co: Responsive design duplicates often bloat CSS significantly without visible utility. Integrate modern approach principles with smart CSS bundlers that facilitate absolute minification, preventing bloated output targeting tiny screens which slow down mobile experience for many users.
Minified:
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/genesis-blocks/dist/style-blocks.build.css?ver=1761151307
https://www.lever.co/wp-includes/blocks/navigation/style.min.css?ver=6.8.3
https://www.lever.co/wp-includes/blocks/image/style.min.css?ver=6.8.3
https://www.lever.co/wp-includes/blocks/cover/style.min.css?ver=6.8.3
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/metronet-profile-picture/dist/blocks.style.build.css?ver=1761151307
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/accordion-blocks/build/index.css?ver=1761151308
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/fse-pro/assets/css/style.css?ver=1761151308
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-includes/css/dashicons.min.css?ver=1761151310
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/uploads/fonts/d1c78dae9dce76adcc981689089c3929/font.css?ver=1761151309
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/catch-fse/style.css?ver=1761151309
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/theme.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/kuya.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/custom-style.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/custom-lev-3mw.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/catch-fse/style.css?ver=1761151309


included in the page
Minify JavaScriptMinify JavaScript tips for lever.co: Modern front-end bundlers like Rollup or Vite automatically handle advanced JavaScript minification along with tree-shaking unused code, enabling webmasters to deliver highly optimized code to visitors and search engine crawlers alike in search rankings.
Minified:
https://www.lever.co/wp-content/plugins/nelio-ab-testing/assets/dist/js/visitor-type.js?ver=fed1bd0d2f7778dac059
https://www.lever.co/wp-includes/js/jquery/jquery.min.js?ver=3.7.1
https://www.lever.co/wp-includes/js/jquery/jquery-migrate.min.js?ver=3.4.1
https://plausible.io/js/script.tagged-events.js
//659-JST-226.mktoweb.com/js/forms2/js/forms2.min.js
https://www.lever.co/wp-content/plugins/accordion-blocks/js/accordion-blocks.min.js?ver=1.5.0
https://www.lever.co/wp-content/plugins/wp-rocket/assets/js/lazyload/17.8.3/lazyload.min.js


detected during site scan
Structured DataStructured Data tips for lever.co: Using schema can positively influence featured snippets when applying direct answers pattern accurately, answering queries instantly without visiting the site.
no structured data data for lever.co
2026-08-14T09:17:06+00:00
CDN UsageCDN Usage tips for lever.co: Optimize your static file handling by strategically replacing origin server delivery with a CDN designed for CDNs; serving large, frequently accessed image files like heroes and thumbnails through CDN infrastructure significantly lessens the global burden on your origin servers
content is delivered via CDN
SSL certificatesSSL certificates tips for lever.co: SSL communication prevents attackers from sniffing traffic or tampering with data in transit, reliably securing user sessions on your website, a fundamental security practice that fosters user confidence and trust.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:199 285
Minimum Daily Visits:232 899
Minimum Daily Page Views:400 970
Minimum Monthly Unique Visitors:5 978 550
Minimum Monthly Visits:6 986 970
Minimum Monthly Page Views:12 029 100
Minimum Yearly Unique Visitors:71 742 600
Minimum Yearly Visits:83 843 640
Minimum Yearly Page Views:144 349 200
Maximum Daily Unique Visitors:252 107
Maximum Daily Visits:268 914
Maximum Daily Page Views:453 793
Maximum Monthly Unique Visitors:7 563 210
Maximum Monthly Visits:8 067 420
Maximum Monthly Page Views:13 613 790
Maximum Yearly Unique Visitors:90 758 520
Maximum Yearly Visits:96 809 040
Maximum Yearly Page Views:163 365 480

Estimated Valuation

Daily Revenue:US$ 288 - 648
Monthly Revenue:US$ 8 640 - 19 440
Yearly Revenue:US$ 103 680 - 233 280

Estimated Worth

Minimum:US$ 155 520
Maximum:US$ 699 840

Similarly Ranked Sites

RankPoints
r2games.comr2games.com5 4046 203 103
fuskator.comfuskator.com5 4056 203 103
questionablecontent.netquestionablecontent.net5 4066 203 102
thumbtack.comthumbtack.com5 4076 203 102
watchmygirlfriend.tvwatchmygirlfriend.tv5 4086 203 101
lever.colever.co5 4096 203 101
game-game.com.uagame-game.com.ua5 4106 203 101
dstv.comdstv.com5 4116 203 100
redlink.com.arredlink.com.ar5 4126 203 100
boyfriendtv.comboyfriendtv.com5 4136 203 099
hatenadiary.jphatenadiary.jp5 4146 203 099